PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G04390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 269aa    MW: 27300 Da    PI: 6.16
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G04390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.79.2e-5556151297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdrflPianvsrimk+ lPanakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe yv +lk yl++yre+eg
  OPUNC08G04390.1  56 KEQDRFLPIANVSRIMKRSLPANAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEAYVVSLKSYLNRYREAEG 149
                      89*******************************************************************************************9 PP

            NF-YB  96 ek 97 
                      ek
  OPUNC08G04390.1 150 EK 151
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-5053154IPR009072Histone-fold
SuperFamilySSF471133.11E-3758156IPR009072Histone-fold
PfamPF008087.2E-2761125IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-1789107No hitNo description
PROSITE patternPS00685092108IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-17108126No hitNo description
PRINTSPR006151.1E-17127145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MKSRKSYGQQ SHHLLSPVGS PPSDNESGAA AAAAAAAGGC GSSAGYGCGG GDSPAKEQDR  60
FLPIANVSRI MKRSLPANAK ISKEAKETVQ ECVSEFISFV TGEASDKCQR EKRKTINGDD  120
LLWAMTTLGF EAYVVSLKSY LNRYREAEGE KAAVLGGGAR HGEGGGADSV VIDGHSPLAG  180
GLSQQHQQQD GGGDVGLMMG GAAGAVGYST GAGSTTTAFY APATAASGNK AYCGGDGSRV  240
MDFEGIGGEE ESGGGGERGF AGHLHGVRW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4656146292Transcription factor HapC (Eurofung)
4g92_B5e-4656146292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1246480.0AB124648.1 Oryza sativa Indica Group Hd5 gene for Heading date 5, complete cds, cultivar:Kasalath.
GenBankAB1246490.0AB124649.1 Oryza sativa Indica Group Hd5 mRNA for Heading date 5, complete cds, cultivar:Kasalath.
GenBankAY0621820.0AY062182.1 Oryza sativa (indica cultivar-group) HAP3-like transcriptional-activator (HAP3b) mRNA, complete cds.
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankCT8377940.0CT837794.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA121O04, full insert sequence.
GenBankLC0167120.0LC016712.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Qiu Zhao Zong.
GenBankLC0167130.0LC016713.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Tupa 121-3.
GenBankLC0167160.0LC016716.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Deng Pao Zhai.
GenBankLC0167180.0LC016718.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Naba.
GenBankLC0167190.0LC016719.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bei Khe.
GenBankLC0167210.0LC016721.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bleiyo.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649101.11e-105PREDICTED: nuclear transcription factor Y subunit B-2
TrEMBLA0A0E0LRT50.0A0A0E0LRT5_ORYPU; Uncharacterized protein
STRINGLOC_Os08g07740.11e-104(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-58nuclear factor Y, subunit B3